PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0015s0060.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 283aa    MW: 31880.9 Da    PI: 7.7622
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0015s0060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.67.1e-18193227135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          Cs+C + kTp+WR gp g+ktLCnaCG++y++ +l
  Kaladp0015s0060.1.p 193 CSHCASEKTPQWRTGPMGPKTLCNACGVRYKSGRL 227
                          *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.9E-761281IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.622187223IPR000679Zinc finger, GATA-type
SMARTSM004011.0E-17187237IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.19E-14191251No hitNo description
Gene3DG3DSA:3.30.50.104.2E-14191225IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.80E-15192239No hitNo description
PROSITE patternPS003440193218IPR000679Zinc finger, GATA-type
PfamPF003208.5E-16193227IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MDEFFRVDDL LNFSNDDHGL SSITSDHYDH QHQQFESTSE HMNHQLKSHF GGNNNLHRFN  60
NNSSFSSGTG LGAAGADSIG AHHFSYDFTD QLYVPNDDVS ELEWLSNFVD DSFTDFNTND  120
LTVTLMSRSH SSIPSAARSK RSRQRTWKAS TSLISSSPAP QMDRSRTKSK QGMNSMSEFV  180
DESSSSSSGV RRCSHCASEK TPQWRTGPMG PKTLCNACGV RYKSGRLVPE YRPAASPTFV  240
LTQHSNSHRK VMELRRQKEV TIKQQQQQGH VYHHTHDFQV CR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139144KRSRQR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002277959.12e-82PREDICTED: GATA transcription factor 4
SwissprotO497433e-65GATA4_ARATH; GATA transcription factor 4
TrEMBLF6GV653e-82F6GV65_VITVI; Putative uncharacterized protein
STRINGVIT_15s0021g02510.t017e-82(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.11e-65GATA transcription factor 4